Projects of db.astro.rug.astro-wise.org

Total number of projects 65
Total number of users 318

ID Project Privileges Instrument Member of Member count Manager(s)
1 ALL 4 None True public
10 ACS@HST 4 ACS True public
101 WORKSHOP2005 2 WFI True 42
102 BONN2005 2 None False 14
103 LEIDENTUTORIAL2008 2 None False 17 AWJMCFARLAND
104 TUTORIAL2014 2 None False 7 AWEHELMICH, AWGVERDOES
105 TUTORIAL2015 2 None False 13 AWEHELMICH, AWGVERDOES, AWJDEJONG, AWJMCFARLAND
11 LBCBLUE@LBT 4 LBCBLUE True public
115 TESTCOMALS 2 ACS False 10
119 TESTATLAS3D 2 None False 0
12 VESUVIO 4 OMEGACAM True public
13 OCAM ILT 2 OCAM False 10
14 KIDS 2 OMEGACAM False 94 AWADVORNIK, AWAGRADO, AWARIFATTO, AWCTORTORA, AWDBOXHOORN, AWDKLAES, AWEDEUL, AWEHELMICH, AWEPUDDU, AWEVALENTYN, AWFGETMAN, AWGCOVONE, AWGSIKKEMA, AWGVERDOES, AWHBUDDELMEIJER, AWJBOUT, AWJDEJONG, AWJMCFARLAND, AWKKUIJKEN, AWMBILICKI, AWMDALLORA, AWMIRWIN, AWMPAOLILLO, AWMRADOVICH, AWNNAPOLITANO, AWOCORDES, AWPHUDELOT, AWRSAGLIA, AWTERBEN
15 COMALS 5 ACS True public AWGVERDOES
16 COMETS 2 None False 2
17 OCAMVSTGT 2 OMEGACAM False 3
18 STUDENTWISE 4 None True public AWABELIKOV
19 ATLAS3D 2 None False 0
2 MDM8K 4 MDM8K True public
20 MONICA@WENDELSTEIN 4 MONICA True public
201 TESTALL 2 None False 9 AWDBOXHOORN, AWEHELMICH, AWGSIKKEMA, AWGVERDOES, AWHBUDDELMEIJER, AWJDEJONG, AWJMCFARLAND, AWKBEGEMAN, AWWVRIEND
202 COMM2011 2 OMEGACAM False 16 AWDBOXHOORN, AWEHELMICH, AWEVALENTYN, AWGSIKKEMA, AWGVERDOES, AWJBOUT, AWJDEJONG, AWJMCFARLAND
21 ULTRAVISTA 2 None False 5
22 ISAAC@VLT 2 ISAAC False 6
23 LBCRED@LBT 4 LBCRED True public
24 WFCAM@UKIRT 4 WFCAM True public
25 UKIDSS 2 WFCAM False 6 AWJMCFARLAND
26 MEGACAM@CFHT 4 MEGACAM True public AWGSIKKEMA, AWGVERDOES, AWJBOUT
27 OCAM 2008 2 OCAM False 10
28 GRATAMA@BLAAUW 4 GRATAMA True public AWJMCFARLAND
29 ANDICAM@CTIO1.3m 4 ANDICAM True public AWJMCFARLAND
3 OCAM@VST 4 OCAM True public
30 WISER 2 MEGACAM False 8 AWJMCFARLAND
31 OMA 2 WFI False 3
32 OCAM2009 2 OCAM False 10
33 VIRCAM@VISTA 4 VIRCAM True public AWJMCFARLAND
34 VIKING 2 None False 36 AWABELIKOV, AWEHELMICH, AWGVERDOES, AWJBOUT, AWJMCFARLAND, AWJPIZAGNO, AWRWILLIAMS
35 ESOSCHMIDT@ESO1m 5 ESOSCHMIDT True public AWEHELMICH, AWGVERDOES
36 OMEGACAM@VST 4 OMEGACAM True public AWADVORNIK, AWDBOXHOORN, AWEHELMICH, AWEVALENTYN, AWGSIKKEMA, AWGVERDOES, AWJBOUT, AWJDEJONG, AWJMCFARLAND, AWMBILICKI
37 EUCLID 2 None False 49 AWEHELMICH
38 OMEGAWHITE 2 OMEGACAM False 8 AWDBOXHOORN, AWEHELMICH, AWGVERDOES, AWKBEGEMAN, AWPGROOT, AWSMACFARLANE
39 ACAM@WHT 4 ACAM True public AWEHELMICH, AWGVERDOES, AWJMCFARLAND
4 PDS 4 PDS True public
40 OMEGADWARFS 2 OMEGACAM False 11 AWEHELMICH, AWETOLSTOY, AWGSIKKEMA, AWGVERDOES, AWJDEJONG, AWTDEBOER
41 ATLAS 4 OMEGACAM True public AWEHELMICH, AWGVERDOES, AWJDEJONG, AWJMCFARLAND
42 VPHASPLUS 4 OMEGACAM True public
43 DECAM@BLANCO 4 DECAM True public AWATUDORICA, AWGVERDOES, AWJMCFARLAND
44 HERCULES 2 OMEGACAM False 10 AWDBOXHOORN, AWEVALENTYN, AWGVERDOES, AWJBOUT, AWJMCFARLAND, AWKBEGEMAN
45 VOICE 2 OMEGACAM False 21 AWEHELMICH, AWGCOVONE, AWGVERDOES, AWMVACCARI
46 FOCUS 2 OMEGACAM False 36 AWAVENHOLA, AWEHELMICH, AWGSIKKEMA, AWGVERDOES, AWJMCFARLAND, AWRPELETIER
47 MICADO@E-ELT 4 MICADO True public AWGVERDOES, AWJMCFARLAND, AWWVRIEND
48 KIDS-PHOTZTEST 2 OMEGACAM False 6 AWEHELMICH, AWGVERDOES, AWJDEJONG, AWKKUIJKEN
49 SPARCS 2 DECAM False 5 AWATUDORICA, AWEHELMICH, AWGVERDOES, AWHHILDEBRANDT, AWJMCFARLAND
5 WFC@INT 4 WFC True public
50 OMEGACLUSTER 2 OMEGACAM False 6 AWEHELMICH, AWGVERDOES, AWMVANDENBERG, AWSVATS
5030 DDT295A5030 2 OMEGACAM False 4 AWDBOXHOORN, AWJDEJONG, AWJMCFARLAND, AWNNAPOLITANO
51 AMIGADEEP 2 OMEGACAM False 7 AWEHELMICH, AWGVERDOES, AWJMCFARLAND
52 OMEGALAE 2 OMEGACAM False 5 AWDBOXHOORN, AWGVERDOES, AWJMCFARLAND
53 DEEPCLUSTERS 2 WFC False 11 AWAVENHOLA, AWGSIKKEMA, AWJMCFARLAND
6 WFI@2.2m 4 WFI True public
7 WENSS 4 WSRT True public AWWVRIEND
8 LOFAR 2 LOFAR False 4
9 SUP@SUBARU 4 SUP True public AWJMCFARLAND
9225 AWJMCFARLAND 0 None False 0
9233 AWDEMO 1 None False 0

All users

All users

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

AWDBOXHOORNAWJDEJONGAWJMCFARLAND
AWNNAPOLITANO

All public data for WFC

All public data for OmegaCAM. OmegaCAM is a 1 square degree wide field, optical, 16k X 16k pixel camera for the VLT Survey Telescope (VST) on Paranal Observatory.

All public data for WFI

VST GTO Hercules supercluster

OmegaCAM lab tests

UKIDSS (UKIRT Infrared Deep Sky Survey) is the next generation near-infrared sky survey, the successor to 2MASS using the infrared WFCAM survey instrument attached to the UK InfraRed Telescope (UKIRT) on Mauna Kea, Hawaii. UKIDSS began in May 2005 and will survey 7500 square degrees of the Northern sky, extending over both high and low Galactic latitudes, in JHK to K=18.3. This depth is three magnitudes deeper than 2MASS. UKIDSS will be the true near-infrared counterpart to the Sloan survey, and will produce as well a panoramic clear atlas of the Galactic plane.

INT data for Virtual Observations lecture series

MYDB for AWDEMO

All users

Astro-Wise Workshop - 14-18 November 2005, Lorentz Center, Leiden.

All users

A census of the close-binary population in old open clusters.

All users

AWATUDORICAAWAVENHOLAAWEHELMICH
AWEPETRILLOAWGVERDOESAWMVANDENBERG
AWSVATS

AWDBOXHOORNAWEHELMICHAWETOLSTOY
AWEVALENTYNAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLAND
AWKKUIJKENAWTDEBOER

AWAUSOVAWDBOXHOORNAWEVALENTYN
AWWVRIEND

FOrnax Cluster Ultradeep Survey

AWABELIKOVAWBPILADIEZAWBVENEMANS
AWCBLOKZIJLAWCSIFONAWDBOXHOORN
AWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJBOUTAWJDEJONGAWJMCFARLAND
AWJMWEBAZEAWJPIZAGNOAWKBEGEMAN
AWKKUIJKENAWMCACCIATOAWMCAPACCIOLI
AWMNEESERAWMRADOVICHAWNIRISARRI
AWNWISSEAWPHERAUDEAUAWRBENDER
AWRSAGLIAAWRSILVOTTIAWRVANDERBURG
AWRWILLIAMSAWSCASEWELLAWSVLAAR
AWTERBENAWWVRIENDAWYMELLIER

None

The initial aim of ATLAS is to survey 4500 deg2 of the Southern Sky at high galactic latitudes to comparable depths to the SDSS in the North. The VST ATLAS will be the first step towards a panoramic digital survey of the Southern Sky in the optical bands.

All public data for PDS

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

AWGVERDOESAWJBOUT

AWABELIKOVAWEHELMICHAWGVERDOES
AWHBUDDELMEIJERAWJMCFARLANDAWKBEGEMAN

Sandbox for Astro-WISE tutorial users.

All public data for OCAM

All users

All public data for VIRCAM

The Wide-field Imaging Survey Evaluation of Readiness (WISER) project seeks to evaluate the readiness of our system to deal with large-scale survey data from wide-field imagers.

Data for the VISTA Kilo-degree Infrared Galaxy survey.

All users

All users

The HST-ACS Coma Legacy Survey

All users

AWAVENHOLAAWDBOXHOORNAWEHELMICH
AWGVERDOESAWJMCFARLANDAWPRAMIREZMORETA
AWRPELETIER

Project for the public data from the ANDICAM (A Novel Dual Imaging CAMera) mounted on the former 1.3m 2MASS telescope at Cerro Tololo observatory, Chile. The ANDICAM has two detectors that can operate simultaneously, observing the same pointing in both the optical and near-infrared.

All users

OMA (ontological machine for Astro-Wise) is a prototype of the system for incorporation of external data sources in Astro-Wise. It will be used to test scientific use cases for OMA as well.

In december 2009 the CCD 'Sculptor' of the OmegaCAM detector was replaced. The data in this project were taken to confirm the success of this procedure. RawFitsData were created artificially; the order of extensions is not constant or the same as in the other OCAM datasets.

AWATUDORICAAWEHELMICHAWGVERDOES
AWHHILDEBRANDTAWJMCFARLAND

Testing the photometric redshift and shear measurements of the Kilo Degree Survey

All public data for all instruments

WFCAM is a near-IR wide field camera for the UKIRT telescope on Mauna Kea, Hawaii that has been designed specifically to carry out large-scale survey observations such as the UKIRT Infrared Deep Sky Survey (UKIDSS).

OmegaWhite is a variability survey aimed at periods of less than 2 hours. Using the wide-field camera OmegaCam on the VLT Survey Telescope (VST) 400 square degrees will be monitored for 2 hours in g' and in addition colour information will be obtained by imaging the same area in u', r', i' and narrow band He (5015) and Halpha filters. OmegaWhite is part of the European Galactic Plane Surveys (EGAPS). For additional information on OmegaWhite please have a look at this OmegaWhite survey website - http://www.astro.ru.nl/omegawhite/

AWDBOXHOORNAWEHELMICHAWGRAMSAY
AWGVERDOESAWKBEGEMANAWPGROOT
AWRTOMAAWSMACFARLANE

Project for the public data from the 0.4m Gratama telescope at the Blaauw Observatory atop the Bernoulliborg in Groningen, The Netherlands, run by the Kapteyn Institute.

1700 Square degree 5 band survey of the equatorial strip and 2dF South region

AWABOSELLIAWAGRADOAWAHELMI
AWAVENHOLAAWDBOXHOORNAWEGREBEL
AWEHELMICHAWEIODICEAWELAURIKAINEN
AWETOLOBAAWEVALENTYNAWFLABARBERA
AWGHENSLERAWGSIKKEMAAWGVANDEVEN
AWGVERDOESAWHBUDDELMEIJERAWHSALO
AWJDEJONGAWJFALCONBARROSOAWJJANZ
AWJMCFARLANDAWKKUIJKENAWMCAPACCIOLI
AWMHILKERAWMPAOLLILOAWNNAPOLITANO
AWRMUNOZAWRPELETIERAWSMIESKE
AWSPAUDELAWSTRAGERAWTLISKER
AWTPUZIAAWTSAIFOLLAHIAWVSPRINGEL

All users

All users

This project contains all public data from the MONICA CCD camera on the 0.8m telescope at Wendelstein Observatory, operated by the Institute for Astronomy and Astrophysics of the University of Munich.

AWDBOXHOORNAWDSOBRALAWGVERDOES
AWJMATTHEEAWJMCFARLAND

Euclid is an ESA medium class mission selected for launch in 2019 in the Cosmic Vision 2015-2025 programme

AWAKARICKAWCOMALSAWDBOXHOORN
AWEHELMICHAWEVALENTYNAWGVERDOES
AWJMCFARLANDAWLDOMINGUEZAWMDENBROK
AWMTEMPELAAR

Subaru is an 8.2 meter optical-infrared telescope at the summit of Mauna Kea, Hawaii, operated by the National Astronomical Observatory of Japan (NAOJ), National Institutes of Natural Science. SuprimeCam is the 10k x 8k mosaic camera at the prime focus.

Search for comets

AWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJMCFARLANDAWKBEGEMANAWWVRIEND

All users

AWAGRADOAWANONYMOUSAWAROJBI
AWCHAINESAWDBOXHOORNAWDWILMAN
AWEBERTINAWEDEULAWEHELMICH
AWEVALENTYNAWFGETMANAWGFEULNER
AWGSIKKEMAAWGVERDOESAWHHILDEBRANDT
AWJDIETRICHAWJKOPPENHOEFERAWJMCFARLAND
AWJSNIGULAAWKBEGEMANAWKKOVAC
AWKKUIJKENAWLHABERZETTLAWLMORALESRUEDA
AWMNEESERAWMPAVLOVAWMPOHLEN
AWMSMITAWMTEMPELAARAWNRAMANUJAM
AWOCORDESAWOSCHMITHUESENAWPGROOT
AWPHERAUDEAUAWRRENGELINKAWRSILVOTTI
AWRVERMEIJAWSLECCIAAWTERBEN
AWTSCHNEIDERAWWVRIENDAWYMELLIER

All users

The HST-ACS Coma Legacy Survey uses new data from the Hubble Space Telescope's Advanced Camera for Surveys and legacy data sources such as Subaru, Isaac Newton Telescope, etc. to study the nature of objects in and around the Coma Cluster.

For testing purposes only.

Search for faint features in the outskirts of isolated galaxies

AWABELIKOVAWABUDDENDIEKAWACHOI
AWADVORNIKAWAEDGEAWAGRADO
AWAJAKOBSAWARIFATTOAWATUDORICA
AWBALTIERIAWBJOACHIMIAWBLAU
AWBPILADIEZAWBVENEMANSAWCBLOKZIJL
AWCHEYMANSAWCMORRISONAWCSIFON
AWCSPINIELLOAWCTORTORAAWDAPPLEGATE
AWDBOXHOORNAWDKLAESAWDWILLIAMS
AWEDEULAWEHELMICHAWEIODICE
AWEPETRILLOAWEPUDDUAWESEMBOLONI
AWEVALENTYNAWEVANUITERTAWFGETMAN
AWFKOEHLINGERAWFLABARBERAAWGCOVONE
AWGDAGOAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWHHILDEBRANDTAWHHOEKSTRA
AWJBOUTAWJDEJONGAWJMCFARLAND
AWJMWEBAZEAWJPEACOCKAWJSNIGULA
AWKBEGEMANAWKKUIJKENAWLKELVIN
AWLMILLERAWMBILICKIAWMCACCIATO
AWMCAPACCIOLIAWMCOSTADUARTEAWMDALLORA
AWMIRWINAWMMAHLKEAWMPAOLILLO
AWMRADOVICHAWMSEGERSAWMSMIT
AWMSPAVONEAWMVELANDERAWMVELLISCIG
AWMVIOLAAWNIRISARRIAWNNAPOLITANO
AWOCORDESAWPHUDELOTAWPNOORISHAD
AWPSCHNEIDERAWPSIMONAWRBENDER
AWRHERBONNETAWRNAKAJIMAAWRPELETIER
AWRSAGLIAAWRVANDERBURGAWSDRIVER
AWSGIODINIAWSSEITZAWSVLAAR
AWSWARRENAWTERBENAWTKITCHING
AWTLISKERAWTSCHRABBACKKRAHEAWTSHANKS
AWWSUTHERLANDAWWVRIENDAWYMELLIER
AWZHUANG

AWARAMESHAWAVENHOLAAWBLAP
AWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWJMCFARLANDAWJVANDENBORN
AWRPELETIERAWTVOS

Commissioning data for OmegaCAM, mostly taken from March through June of 2011.

AWADVORNIKAWCSPINIELLOAWEHELMICH
AWEIODICEAWGDAGOAWGVERDOES
AWJDEJONGAWJMCFARLANDAWLKELVIN
AWMBILICKIAWMSPAVONEAWRPELETIER
AWTSAIFOLLAHI

One of three large surveys on the William Herschel Telescope (WHT) will be WEAVE-Clusters using the WEAVE Spectrograph. This will study cluster evolution through an analysis of the internal kinematics and stellar populations of dwarf galaxies. In preparation of this survey, deep imaging will be obtained with Wide Field Camera (WFC) on the Isaac Newton Telescope (INT) for some of these clusters. The resulting data set will be analyzed using special photometric techniques developed for the VST-Fornax Survey.

All users

AWEDEMOOIJAWEDEULAWEHELMICH
AWEVANUITERTAWGVERDOESAWHHILDEBRANDT
AWISNELLENAWJHOLTAWJMCFARLAND
AWKKUIJKENAWKVERBEEKAWMFRANX
AWMSMITAWMVELANDERAWOSPOOREN
AWRWILLIAMSAWTSCHRABBACKKRAHE

The Large Binocular Camera (red arm) at the Large Binocular Telescope at Mount Graham

VST/OmegaCAM Exploration of SUperclusters Voids and Intermediate Objects

All users

All users

AWEHELMICHAWGVERDOESAWJHOLT
AWJMCFARLANDAWMFRANXAWRWILLIAMS

Ultra deep near-infrared survey for the early Universe.

All users

AWABELIKOVAWDBOXHOORNAWEDEUL
AWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJBOUT
AWJDEJONGAWJMCFARLANDAWJPIZAGNO
AWKBEGEMANAWKKUIJKENAWRHOOK
AWWVRIEND

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND

The Spitzer Adaptation of the Red-sequence Cluster Survey is a z'-passband imaging survey of the SWIRE Legacy Survey Fields. Observations of the six fields have been made at all seven Spitzer (3.6, 4.5, 5.8, 8.0, 24, 70, 160 micron) passbands. SpARCS consists of deep (z'= 24 AB) observations made from both hemispheres using MegaCam at CFHT (Northern Fields) and MOSAICII at CTIO (Southern Fields). The cluster detection (z'-imaging) phase is now complete and has yielded hundreds of z > 1 cluster candidates detected based upon z'-[3.6] color. With a total effective area of 41.9 square degrees, SpARCS is currently the largest completed z > 1 cluster survey. This project is for the processing of new (DECAM) and legacy SpARCS data.

Einstein cross around a massive super-compact galaxy in the KiDS survey: a VST follow-up

Test project for AIUB

All users

Contains scans of photographic plates taken with the ESO Schmidt 1m telescope on La Silla.

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND

LOw Frequency ARray - The largest radio telescope in the world

DECam is the 3 square-degree (2.2 degree wide) Dark Energy Camera mounted on the 4.0m Blanco telescope at Cerro Tololo Inter-American Observatory (CTIO) in central Chile for the purpose of collecting data for DES, the Dark Energy Survey.

VOICE aims at covering 4 square degrees around the CDFS in deep ugri imaging.

AWABELIKOVAWGSIKKEMAAWGVERDOES

AWDBOXHOORNAWEHELMICHAWGVERDOES
AWMHEEMSKERKAWMVANDENBERGAWSVATS

Groningen tutorial, July 10 and 11.

Leiden Tutorial. August 18-20.

ACAM is mounted permanently at a folded-Cassegrain focus of the 4.2-m William Herschel Telescope. It can be used for high-throughput broad-band imaging, narrow-band imaging and low-resolution spectroscopy.

This project contains data taken during the OmegaCAM integration test of October 2008. Instrument and detector were reassembled on Paranal, but not joined together. The shutter and filter mechanics were operated but not present in front of the detector.

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWJBOUT
AWJMCFARLANDAWKBEGEMANAWLKELVIN
AWWVRIEND

AWEVALENTYNAWGVERDOESAWJMCFARLAND

The nature, clustering and evolution of Lyman-¿ emitters with the largest Lyman-¿ survey at z ¿ 2.4

The Westerbork Northern Sky Survey

AWDBOXHOORNAWEHELMICHAWGVERDOES
AWHHILDEBRANDTAWJDEJONGAWKKUIJKEN

All users

MICADO will be a near-infrared wide-field camera at the European Extremely Large Telescope.

AWACHOIAWCHEYMANSAWCSIFON
AWDAPPLEGATEAWDBOXHOORNAWEHELMICH
AWFGETMANAWGCOVONEAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJDEJONGAWJMCFARLANDAWKKUIJKEN
AWMRADOVICHAWMVACCARIAWMVIOLA
AWNNAPOLITANOAWRVANDERBURGAWTERBEN

All public data for ACS

AWABELIKOVAWDBOXHOORNAWEHELMICH
AWGVERDOESAWJMCFARLANDAWJMWEBAZE
AWKBEGEMANAWWVRIEND

The VST/OmegaCam Photometric H¿ Survey of the Southern Galactic Plane.

MegaPrime is the wide-field optical imaging facility at CFHT (Canada-France-Hawaii telescope) atop Mauna Kea, Hawaii. At the heart of MegaPrime is the wide-field imager, MegaCam, consisting of 36 2048 x 4612 pixel CCDs (a total of 340 megapixels), covering a full 1 degree x 1 degree field-of-view with a resolution of 0.187 arcsecond per pixel to properly sample the 0.7 arcsecond median seeing offered by the CFHT at Mauna Kea.

AWBBURGGRAFAWCTRACHTERNACHAWDBOMANS
AWDROSENBAUMAWFBRIMIOULLEAWHHILDEBRANDT
AWHISRAELAWJDIETRICHAWKWEIS
AWMLERCHSTERAWOCORDESAWOSCHMITHUESEN
AWTERBENAWTSCHRABBACKKRAHE

None

All users

All users

The Large Binocular Camera (blue arm) at the Large Binocular Telescope at Mount Graham

MYDB for JMCFARLAND

All users

All users

AWEHELMICHAWGVERDOESAWJHOLT
AWJMCFARLANDAWMFRANX

AWABELIKOVAWACHAMBALLUAWAJAFFE
AWAPIEMONTEAWATSYGANOVAWBDROEGE
AWBNICHOLAWCBACCIGALUPIAWCROUSSEL
AWCTAOAWDBOXHOORNAWEAUBOURG
AWEHELMICHAWEVALENTYNAWFABDALLA
AWFRAISONAWGBLANCAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJKOPPENHOEFERAWJMCFARLANDAWJMOHR
AWJPIZAGNOAWJSNIGULAAWKBEGEMAN
AWKGANGAAWKKUIJKENAWMJARVIS
AWMKUEMMELAWMSAUVAGEAWMVACCARI
AWMWETZSTEINAWNBUSCAAWOLAHAV
AWOMARGGRAFAWPHUDELOTAWRCABANAC
AWRHENDERSONAWRSAGLIAAWRWILLIAMS
AWSDESAIAWSSERJEANTAWTERBEN
AWTGIANNANTONIOAWVBECKMANNAWWVRIEND
AWYMELLIER

All users

All users

All users

OmegaCAM/VST Guaranteed Time

All public data for MDM8K