Projects of db.astro.rug.astro-wise.org

Total number of projects 71
Total number of users 347

ID Project Privileges Instrument Member of Member count Manager(s)
1 ALL 4 None True public
2 MDM8K 4 MDM8K True public
3 OCAM@VST 4 OCAM True public
4 PDS 4 PDS True public
5 WFC@INT 4 WFC True public
6 WFI@2.2m 4 WFI True public
12 VESUVIO 4 OMEGACAM True public
13 OCAM ILT 2 OCAM False 10
14 KIDS 2 OMEGACAM False 76 AWADVORNIK, AWAGRADO, AWARAJ, AWARIFATTO, AWAWRIGHT, AWCTORTORA, AWDBOXHOORN, AWDKLAES, AWEDEUL, AWEHELMICH, AWEPUDDU, AWEVALENTYN, AWFGETMAN, AWGCOVONE, AWGSIKKEMA, AWGVERDOES, AWHBUDDELMEIJER, AWJDEJONG, AWJMCFARLAND, AWKKUIJKEN, AWMBILICKI, AWMDALLORA, AWMIRWIN, AWMPAOLILLO, AWMRADOVICH, AWNNAPOLITANO, AWOCORDES, AWPHUDELOT, AWTERBEN
101 WORKSHOP2005 2 WFI False 42
36 OMEGACAM@VST 4 OMEGACAM True public AWADVORNIK, AWARAJ, AWDBOXHOORN, AWEHELMICH, AWEVALENTYN, AWFGETMAN, AWGSIKKEMA, AWGVERDOES, AWJBOUT, AWJDEJONG, AWJMCFARLAND, AWKKUIJKEN, AWMBILICKI
202 COMM2011 2 OMEGACAM False 16 AWDBOXHOORN, AWEHELMICH, AWEVALENTYN, AWGSIKKEMA, AWGVERDOES, AWJBOUT, AWJDEJONG, AWJMCFARLAND
37 EUCLID 2 None False 50 AWEHELMICH
38 OMEGAWHITE 2 OMEGACAM False 8 AWDBOXHOORN, AWEHELMICH, AWGVERDOES, AWKBEGEMAN, AWPGROOT, AWSMACFARLANE
40 OMEGADWARFS 2 OMEGACAM False 11 AWEHELMICH, AWETOLSTOY, AWGSIKKEMA, AWGVERDOES, AWJDEJONG, AWTDEBOER
41 ATLAS 4 OMEGACAM True public AWEHELMICH, AWGVERDOES, AWJDEJONG, AWJMCFARLAND
42 VPHASPLUS 4 OMEGACAM True public
43 DECAM@BLANCO 4 DECAM True public AWATUDORICA, AWGVERDOES, AWJMCFARLAND
44 HERCULES 2 OMEGACAM False 11 AWDBOXHOORN, AWEVALENTYN, AWGVERDOES, AWJBOUT, AWJMCFARLAND, AWKBEGEMAN
45 VOICE 2 OMEGACAM False 21 AWEHELMICH, AWGCOVONE, AWGVERDOES, AWMVACCARI
104 TUTORIAL2014 2 None False 7 AWEHELMICH, AWGVERDOES
50 OMEGACLUSTER 2 OMEGACAM False 6 AWEHELMICH, AWGVERDOES, AWMVANDENBERG, AWSVATS
51 AMIGADEEP 2 OMEGACAM False 7 AWEHELMICH, AWGVERDOES, AWJMCFARLAND
52 OMEGALAE 2 OMEGACAM False 5 AWDBOXHOORN, AWGVERDOES, AWJMCFARLAND
5030 DDT295A5030 2 OMEGACAM False 4 AWDBOXHOORN, AWJDEJONG, AWJMCFARLAND, AWNNAPOLITANO
9225 AWJMCFARLAND 0 None False 0
105 TUTORIAL2015 2 None False 14 AWEHELMICH, AWGVERDOES, AWJDEJONG, AWJMCFARLAND
54 KABS 2 OMEGACAM False 14 AWARAJ, AWFGETMAN
57 ALICE 2 OMEGACAM False 2 AWFGETMAN, AWMRADOVICH
8 LOFAR 2 LOFAR False 4
10 ACS@HST 4 ACS True public
115 TESTCOMALS 2 ACS False 10
11 LBCBLUE@LBT 4 LBCBLUE True public
20 MONICA@WENDELSTEIN 4 MONICA True public
22 ISAAC@VLT 2 ISAAC False 6
201 TESTALL 2 None False 9 AWDBOXHOORN, AWEHELMICH, AWGSIKKEMA, AWGVERDOES, AWHBUDDELMEIJER, AWJDEJONG, AWJMCFARLAND, AWKBEGEMAN, AWWVRIEND
25 UKIDSS 2 WFCAM False 6 AWJMCFARLAND
24 WFCAM@UKIRT 4 WFCAM True public
103 LEIDENTUTORIAL2008 2 None False 17 AWJMCFARLAND
27 OCAM 2008 2 OCAM False 10
31 OMA 2 WFI False 3
33 VIRCAM@VISTA 4 VIRCAM True public AWJMCFARLAND
35 ESOSCHMIDT@ESO1m 5 ESOSCHMIDT True public AWEHELMICH, AWGVERDOES
39 ACAM@WHT 4 ACAM True public AWEHELMICH, AWGVERDOES, AWJMCFARLAND
7 WENSS 4 WSRT True public AWWVRIEND
9233 AWDEMO 1 None False 0
102 BONN2005 2 None False 14
46 FOCUS 2 OMEGACAM False 42 AWAVENHOLA, AWDBOXHOORN, AWEHELMICH, AWGSIKKEMA, AWGVERDOES, AWJMCFARLAND, AWRPELETIER, AWWVRIEND
47 MICADO@E-ELT 4 MICADO True public AWGVERDOES, AWJMCFARLAND, AWWVRIEND
9 SUP@SUBARU 4 SUP True public AWJMCFARLAND
15 COMALS 5 ACS True public AWGVERDOES
16 COMETS 2 None False 2
17 OCAMVSTGT 2 OMEGACAM False 3
48 KIDS-PHOTZTEST 2 OMEGACAM False 6 AWEHELMICH, AWGVERDOES, AWJDEJONG, AWKKUIJKEN
49 SPARCS 2 DECAM False 5 AWATUDORICA, AWEHELMICH, AWGVERDOES, AWHHILDEBRANDT, AWJMCFARLAND
28 GRATAMA@BLAAUW 4 GRATAMA True public AWJMCFARLAND
18 STUDENTWISE 4 None True public AWABELIKOV
53 DEEPCLUSTERS 2 WFC False 14 AWAVENHOLA, AWDBOXHOORN, AWEHELMICH, AWGSIKKEMA, AWJDEJONG, AWJMCFARLAND, AWNCHOQUE, AWPMANCERAPINA
106 TUTORIAL 2 None False 12 AWEHELMICH, AWJDEJONG
55 PAMC 2 OMEGACAM False 1 AWOCONTIGIANI
56 VEGAS 2 OMEGACAM False 4 AWDBOXHOORN, AWEIODICE, AWMSPAVONE
119 TESTATLAS3D 2 None False 0
19 ATLAS3D 2 None False 0
58 YMCA 2 OMEGACAM False 4 AWDBOXHOORN, AWMGATTO, AWMSPAVONE, AWVRIPEPI
21 ULTRAVISTA 2 None False 5
23 LBCRED@LBT 4 LBCRED True public
26 MEGACAM@CFHT 4 MEGACAM True public AWGSIKKEMA, AWGVERDOES, AWJBOUT
29 ANDICAM@CTIO1.3m 4 ANDICAM True public AWJMCFARLAND
30 WISER 2 MEGACAM False 8 AWJMCFARLAND
32 OCAM2009 2 OCAM False 10
34 VIKING 2 None False 36 AWABELIKOV, AWEHELMICH, AWGVERDOES, AWJBOUT, AWJMCFARLAND, AWJPIZAGNO, AWRWILLIAMS

All users

MegaPrime is the wide-field optical imaging facility at CFHT (Canada-France-Hawaii telescope) atop Mauna Kea, Hawaii. At the heart of MegaPrime is the wide-field imager, MegaCam, consisting of 36 2048 x 4612 pixel CCDs (a total of 340 megapixels), covering a full 1 degree x 1 degree field-of-view with a resolution of 0.187 arcsecond per pixel to properly sample the 0.7 arcsecond median seeing offered by the CFHT at Mauna Kea.

AWDBOXHOORNAWDSOBRALAWGVERDOESAWJMATTHEE
AWJMCFARLAND

The VST/OmegaCam Photometric H¿ Survey of the Southern Galactic Plane.

In december 2009 the CCD 'Sculptor' of the OmegaCAM detector was replaced. The data in this project were taken to confirm the success of this procedure. RawFitsData were created artificially; the order of extensions is not constant or the same as in the other OCAM datasets.

AWEDEMOOIJAWEDEULAWEHELMICHAWEVANUITERT
AWGVERDOESAWHHILDEBRANDTAWISNELLENAWJHOLT
AWJMCFARLANDAWKKUIJKENAWKVERBEEKAWMFRANX
AWMSMITAWMVELANDERAWOSPOORENAWRWILLIAMS
AWTSCHRABBACKKRAHE

KiDS ATLAS Bridging Survey

AWDBOXHOORNAWEHELMICHAWGVERDOESAWHHILDEBRANDT
AWJDEJONGAWKKUIJKEN

Test project for AIUB

Euclid is an ESA medium class mission selected for launch in 2019 in the Cosmic Vision 2015-2025 programme

The Wide-field Imaging Survey Evaluation of Readiness (WISER) project seeks to evaluate the readiness of our system to deal with large-scale survey data from wide-field imagers.

AWDBOXHOORNAWEHELMICHAWGVERDOESAWMHEEMSKERK
AWMVANDENBERGAWSVATS

Groningen tutorial, July 10 and 11.

The initial aim of ATLAS is to survey 4500 deg2 of the Southern Sky at high galactic latitudes to comparable depths to the SDSS in the North. The VST ATLAS will be the first step towards a panoramic digital survey of the Southern Sky in the optical bands.

AWACHOIAWCHEYMANSAWCSIFONAWDAPPLEGATE
AWDBOXHOORNAWEHELMICHAWFGETMANAWGCOVONE
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJDEJONGAWJMCFARLANDAWKKUIJKENAWMRADOVICH
AWMVACCARIAWMVIOLAAWNNAPOLITANOAWRVANDERBURG
AWTERBEN

All users

1700 Square degree 5 band survey of the equatorial strip and 2dF South region

For testing purposes only.

AWDBOXHOORNAWEHELMICHAWETOLSTOYAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJMCFARLANDAWKKUIJKENAWTDEBOER

All users

One of three large surveys on the William Herschel Telescope (WHT) will be WEAVE-Clusters using the WEAVE Spectrograph. This will study cluster evolution through an analysis of the internal kinematics and stellar populations of dwarf galaxies. In preparation of this survey, deep imaging will be obtained with Wide Field Camera (WFC) on the Isaac Newton Telescope (INT) for some of these clusters. The resulting data set will be analyzed using special photometric techniques developed for the VST-Fornax Survey.

All users

All public data for all instruments

Einstein cross around a massive super-compact galaxy in the KiDS survey: a VST follow-up

DECam is the 3 square-degree (2.2 degree wide) Dark Energy Camera mounted on the 4.0m Blanco telescope at Cerro Tololo Inter-American Observatory (CTIO) in central Chile for the purpose of collecting data for DES, the Dark Energy Survey.

AWABELIKOVAWEHELMICHAWGVERDOESAWHBUDDELMEIJER
AWJMCFARLANDAWKBEGEMAN

Sandbox for Astro-WISE tutorial users.

All users

All users

AWARAJAWARIFATTOAWDBOXHOORNAWEPUDDU
AWEVALENTYNAWFGETMANAWFLABARBERAAWGVERDOES
AWJDEJONGAWKKUIJKENAWMDALLORAAWMPAOLILLO
AWMRADOVICHAWNNAPOLITANO

Testing the photometric redshift and shear measurements of the Kilo Degree Survey

AWABELIKOVAWDBOXHOORNAWEHELMICHAWGVERDOES
AWJMCFARLANDAWJMWEBAZEAWKBEGEMANAWWVRIEND
AWGVERDOESAWJBOUT

All public data for OCAM

VST GTO Hercules supercluster

AWARAMESHAWAVENHOLAAWBLAPAWDBOXHOORN
AWEHELMICHAWGSIKKEMAAWGVERDOESAWJDEJONG
AWJMCFARLANDAWJVANDENBORNAWNCHOQUEAWPMANCERAPINA
AWRPELETIERAWTVOS
AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND

A survey to study the star formation history and the extended structure of the outskirts of the Magellanic Clouds

VST/OmegaCAM Exploration of SUperclusters Voids and Intermediate Objects

All public data for VIRCAM

AWEVALENTYNAWGVERDOESAWJMCFARLAND
AWASAVINOAWDBOXHOORNAWDDINGAWEHELMICH
AWJDEJONGAWKFRANTSEVAAWMMAHLKEAWNCHOQUE
AWOCONTIGIANIAWPMANCERAPINAAWTNUTMAAWYDEVRIES
AWFGETMANAWMRADOVICH

All users

MICADO will be a near-infrared wide-field camera at the European Extremely Large Telescope.

AWDBOXHOORNAWEIODICEAWMRADOVICHAWMSPAVONE

The HST-ACS Coma Legacy Survey

AWABELIKOVAWACHOIAWADVORNIKAWAEDGE
AWAGRADOAWARAJAWARIFATTOAWATUDORICA
AWAWRIGHTAWBALTIERIAWBJOACHIMIAWBVENEMANS
AWCHEYMANSAWCMORRISONAWCSIFONAWCSPINIELLO
AWCTORTORAAWDBOXHOORNAWDKLAESAWDWILLIAMS
AWEDEULAWEHELMICHAWEIODICEAWEPETRILLO
AWEPUDDUAWEVALENTYNAWEVANUITERTAWFGETMAN
AWFKOEHLINGERAWFLABARBERAAWGCOVONEAWGDAGO
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWHHOEKSTRAAWJDEJONGAWJMCFARLANDAWJPEACOCK
AWKBEGEMANAWKFRANTSEVAAWKKUIJKENAWLKELVIN
AWLMILLERAWMBILICKIAWMCAPACCIOLIAWMCOSTADUARTE
AWMDALLORAAWMIRWINAWMMAHLKEAWMPAOLILLO
AWMRADOVICHAWMSPAVONEAWMVIOLAAWNNAPOLITANO
AWOCORDESAWPHUDELOTAWPNOORISHADAWPSCHNEIDER
AWPSIMONAWRHERBONNETAWRNAKAJIMAAWRPELETIER
AWRVANDERBURGAWSDRIVERAWTERBENAWTKITCHING
AWTLISKERAWTSCHRABBACKKRAHEAWTSHANKSAWWMULDER
AWWSUTHERLANDAWWVRIENDAWYDEVRIESAWZHUANG

This project contains all public data from the MONICA CCD camera on the 0.8m telescope at Wendelstein Observatory, operated by the Institute for Astronomy and Astrophysics of the University of Munich.

All users

All users

Leiden Tutorial. August 18-20.

All users

AWBBURGGRAFAWCTRACHTERNACHAWDBOMANSAWDROSENBAUM
AWFBRIMIOULLEAWHHILDEBRANDTAWHISRAELAWJDIETRICH
AWKWEISAWMLERCHSTERAWOCORDESAWOSCHMITHUESEN
AWTERBENAWTSCHRABBACKKRAHE

Data for the VISTA Kilo-degree Infrared Galaxy survey.

All public data for OmegaCAM. OmegaCAM is a 1 square degree wide field, optical, 16k X 16k pixel camera for the VLT Survey Telescope (VST) on Paranal Observatory.

AWDBOXHOORNAWEHELMICHAWGRAMSAYAWGVERDOES
AWKBEGEMANAWPGROOTAWRTOMAAWSMACFARLANE

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

All users

In this project we observed with VST-OmegaCam in the ugri bands a sample of galaxy clusters selected from the Planck-SZ catalog at different redshifts. The data will be used to calibrate the mass estimate of the clusters by weak-lensing and the cluster mass/richness relation, that will be applied to larger samples available from other surveys such as KiDS

All users

UKIDSS (UKIRT Infrared Deep Sky Survey) is the next generation near-infrared sky survey, the successor to 2MASS using the infrared WFCAM survey instrument attached to the UK InfraRed Telescope (UKIRT) on Mauna Kea, Hawaii. UKIDSS began in May 2005 and will survey 7500 square degrees of the Northern sky, extending over both high and low Galactic latitudes, in JHK to K=18.3. This depth is three magnitudes deeper than 2MASS. UKIDSS will be the true near-infrared counterpart to the Sloan survey, and will produce as well a panoramic clear atlas of the Galactic plane.

All users

Subaru is an 8.2 meter optical-infrared telescope at the summit of Mauna Kea, Hawaii, operated by the National Astronomical Observatory of Japan (NAOJ), National Institutes of Natural Science. SuprimeCam is the 10k x 8k mosaic camera at the prime focus.

Astro-Wise Workshop - 14-18 November 2005, Lorentz Center, Leiden.

AWEHELMICHAWGVERDOESAWJHOLTAWJMCFARLAND
AWMFRANXAWRWILLIAMS

Commissioning data for OmegaCAM, mostly taken from March through June of 2011.

The HST-ACS Coma Legacy Survey uses new data from the Hubble Space Telescope's Advanced Camera for Surveys and legacy data sources such as Subaru, Isaac Newton Telescope, etc. to study the nature of objects in and around the Coma Cluster.

All users

AWOCONTIGIANI
AWABELIKOVAWGSIKKEMAAWGVERDOES

The Large Binocular Camera (blue arm) at the Large Binocular Telescope at Mount Graham

Search for comets

AWEHELMICHAWGVERDOESAWJHOLTAWJMCFARLAND
AWMFRANX

LOw Frequency ARray - The largest radio telescope in the world

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

All users

MYDB for JMCFARLAND

OmegaCAM/VST Guaranteed Time

AWDBOXHOORNAWMGATTOAWMSPAVONEAWVRIPEPI
AWDBOXHOORNAWJDEJONGAWJMCFARLANDAWNNAPOLITANO

Project for the public data from the ANDICAM (A Novel Dual Imaging CAMera) mounted on the former 1.3m 2MASS telescope at Cerro Tololo observatory, Chile. The ANDICAM has two detectors that can operate simultaneously, observing the same pointing in both the optical and near-infrared.

None

AWADVORNIKAWASUAWCSPINIELLOAWEHELMICH
AWEIODICEAWGDAGOAWGVERDOESAWJDEJONG
AWJMCFARLANDAWLKELVINAWMBILICKIAWMSPAVONE
AWRPELETIERAWTSAIFOLLAHI

Sandbox for Astro-WISE tutorial users.

All users

OMA (ontological machine for Astro-Wise) is a prototype of the system for incorporation of external data sources in Astro-Wise. It will be used to test scientific use cases for OMA as well.

The Spitzer Adaptation of the Red-sequence Cluster Survey is a z'-passband imaging survey of the SWIRE Legacy Survey Fields. Observations of the six fields have been made at all seven Spitzer (3.6, 4.5, 5.8, 8.0, 24, 70, 160 micron) passbands. SpARCS consists of deep (z'= 24 AB) observations made from both hemispheres using MegaCam at CFHT (Northern Fields) and MOSAICII at CTIO (Southern Fields). The cluster detection (z'-imaging) phase is now complete and has yielded hundreds of z > 1 cluster candidates detected based upon z'-[3.6] color. With a total effective area of 41.9 square degrees, SpARCS is currently the largest completed z > 1 cluster survey. This project is for the processing of new (DECAM) and legacy SpARCS data.

VOICE aims at covering 4 square degrees around the CDFS in deep ugri imaging.

AWATUDORICAAWAVENHOLAAWEHELMICHAWEPETRILLO
AWGVERDOESAWMVANDENBERGAWSVATS

MYDB for AWDEMO

None

A census of the close-binary population in old open clusters.

The Large Binocular Camera (red arm) at the Large Binocular Telescope at Mount Graham

AWAKARICKAWCOMALSAWDBOXHOORNAWEHELMICH
AWEVALENTYNAWGVERDOESAWJMCFARLANDAWLDOMINGUEZ
AWMDENBROKAWMTEMPELAAR
AWABELIKOVAWDBOXHOORNAWEDEULAWEHELMICH
AWEVALENTYNAWGSIKKEMAAWGVERDOESAWHBUDDELMEIJER
AWJBOUTAWJDEJONGAWJMCFARLANDAWJPIZAGNO
AWKBEGEMANAWKKUIJKENAWRHOOKAWWVRIEND
AWAVENHOLAAWDBOXHOORNAWEHELMICHAWGVERDOES
AWJMCFARLANDAWPRAMIREZMORETAAWRPELETIER

Project for the public data from the 0.4m Gratama telescope at the Blaauw Observatory atop the Bernoulliborg in Groningen, The Netherlands, run by the Kapteyn Institute.

The nature, clustering and evolution of Lyman-¿ emitters with the largest Lyman-¿ survey at z ¿ 2.4

All users

This project contains data taken during the OmegaCAM integration test of October 2008. Instrument and detector were reassembled on Paranal, but not joined together. The shutter and filter mechanics were operated but not present in front of the detector.

WFCAM is a near-IR wide field camera for the UKIRT telescope on Mauna Kea, Hawaii that has been designed specifically to carry out large-scale survey observations such as the UKIRT Infrared Deep Sky Survey (UKIDSS).

All public data for MDM8K

All public data for ACS

AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND
AWATUDORICAAWEHELMICHAWGVERDOESAWHHILDEBRANDT
AWJMCFARLAND
AWABOSELLIAWAGRADOAWAHELMIAWARAJ
AWASUAWAVENHOLAAWDBOXHOORNAWEGREBEL
AWEHELMICHAWEIODICEAWELAURIKAINENAWETOLOBA
AWEVALENTYNAWFGETMANAWFLABARBERAAWGHENSLER
AWGSIKKEMAAWGVANDEVENAWGVERDOESAWHBUDDELMEIJER
AWHSALOAWJDEJONGAWJFALCONBARROSOAWJJANZ
AWJMCFARLANDAWKKUIJKENAWMCAPACCIOLIAWMHILKER
AWMPAOLLILOAWMSPAVONEAWNNAPOLITANOAWNZABEL
AWRMUNOZAWRPELETIERAWSMIESKEAWSPAUDEL
AWSTRAGERAWTLISKERAWTPUZIAAWTSAIFOLLAHI
AWVSPRINGELAWWVRIEND
AWAGRADOAWANONYMOUSAWAROJBIAWCHAINES
AWDBOXHOORNAWDWILMANAWEBERTINAWEDEUL
AWEHELMICHAWEVALENTYNAWFGETMANAWGFEULNER
AWGSIKKEMAAWGVERDOESAWHHILDEBRANDTAWJDIETRICH
AWJKOPPENHOEFERAWJMCFARLANDAWJSNIGULAAWKBEGEMAN
AWKKOVACAWKKUIJKENAWLHABERZETTLAWLMORALESRUEDA
AWMNEESERAWMPAVLOVAWMPOHLENAWMSMIT
AWMTEMPELAARAWNRAMANUJAMAWOCORDESAWOSCHMITHUESEN
AWPGROOTAWPHERAUDEAUAWRRENGELINKAWRSILVOTTI
AWRVERMEIJAWSLECCIAAWTERBENAWTSCHNEIDER
AWWVRIENDAWYMELLIER

Contains scans of photographic plates taken with the ESO Schmidt 1m telescope on La Silla.

All users

Probing the accretion of matter around massive galaxy clusters with splashback

All users

AWDBOXHOORNAWEHELMICHAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLANDAWKBEGEMAN
AWWVRIEND
AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND

Search for faint features in the outskirts of isolated galaxies

All users

The Westerbork Northern Sky Survey

All public data for WFC

AWABELIKOVAWBPILADIEZAWBVENEMANSAWCBLOKZIJL
AWCSIFONAWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJBOUTAWJDEJONGAWJMCFARLANDAWJMWEBAZE
AWJPIZAGNOAWKBEGEMANAWKKUIJKENAWMCACCIATO
AWMCAPACCIOLIAWMNEESERAWMRADOVICHAWNIRISARRI
AWNWISSEAWPHERAUDEAUAWRBENDERAWRSAGLIA
AWRSILVOTTIAWRVANDERBURGAWRWILLIAMSAWSCASEWELL
AWSVLAARAWTERBENAWWVRIENDAWYMELLIER

None

OmegaCAM lab tests

OmegaWhite is a variability survey aimed at periods of less than 2 hours. Using the wide-field camera OmegaCam on the VLT Survey Telescope (VST) 400 square degrees will be monitored for 2 hours in g' and in addition colour information will be obtained by imaging the same area in u', r', i' and narrow band He (5015) and Halpha filters. OmegaWhite is part of the European Galactic Plane Surveys (EGAPS). For additional information on OmegaWhite please have a look at this OmegaWhite survey website - http://www.astro.ru.nl/omegawhite/

ACAM is mounted permanently at a folded-Cassegrain focus of the 4.2-m William Herschel Telescope. It can be used for high-throughput broad-band imaging, narrow-band imaging and low-resolution spectroscopy.

All users

AWABELIKOVAWACHAMBALLUAWAJAFFEAWAPIEMONTE
AWATSYGANOVAWBDROEGEAWBNICHOLAWCBACCIGALUPI
AWCROUSSELAWCTAOAWDBOXHOORNAWEAUBOURG
AWEHELMICHAWEVALENTYNAWFABDALLAAWFRAISON
AWGBLANCAWGSIKKEMAAWGVERDOESAWHBUDDELMEIJER
AWJDEJONGAWJKOPPENHOEFERAWJMCFARLANDAWJMOHR
AWJPIZAGNOAWJSNIGULAAWKBEGEMANAWKGANGA
AWKKUIJKENAWMJARVISAWMKUEMMELAWMSAUVAGE
AWMVACCARIAWMWETZSTEINAWNBUSCAAWOLAHAV
AWOMARGGRAFAWPHUDELOTAWRCABANACAWRHENDERSON
AWRSAGLIAAWRWILLIAMSAWSDESAIAWSSERJEANT
AWTERBENAWTGIANNANTONIOAWVBECKMANNAWWMULDER
AWWVRIENDAWYMELLIER

All users

Ultra deep near-infrared survey for the early Universe.

FOrnax Cluster Ultradeep Survey

AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWJBOUTAWJMCFARLANDAWKBEGEMAN
AWLKELVINAWRBUTAAWWVRIEND

All public data for PDS

All public data for WFI

All users

AWAUSOVAWDBOXHOORNAWEVALENTYNAWWVRIEND

All users

All users

All users

All users

INT data for Virtual Observations lecture series